| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT3. This antibody reacts with human. The NUDT3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NUDT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRQGYSANNGTPVVATTYSVSAQSSMSGIR |
|---|
| Other Names | Diadenosine 5'-5'''-P1, diphosphoinositol polyphosphate phosphohydrolase 1, DIPP-1, DIPPDIPP1, EC 3.6.1.-, EC 3.6.1.52, Nucleoside diphosphate-linked moiety X motif 3, nudix (nucleoside diphosphate linked moiety X)-type motif 3, Nudix motif 3, P6-hexaphosphate hydrolase 1 |
|---|
| Gene, Accession # | NUDT3, Gene ID: 11165 |
|---|
| Catalog # | NBP2-49205 |
|---|
| Price | |
|---|
| Order / More Info | NUDT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|