| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT4. This antibody reacts with human, mouse, rat. The NUDT4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NUDT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
|---|
| Other Names | Diadenosine 5'-5'''-P1, diphosphoinositol polyphosphate phosphohydrolase 2, diphosphoinositol polyphosphate phosphohydrolase type 2, DIPP-2, DIPP2alpha, DIPP2beta, DIPP2HDCMB47P, EC 3.6.1.-, EC 3.6.1.52, KIAA0487DKFZp686I1281, Nucleoside diphosphate-linked moiety X motif 4, nudix (nucleoside diphosphate linked moiety X)-type motif 4, Nudix motif 4, P6-hexaphosphate hydrolase 2 |
|---|
| Gene, Accession # | NUDT4, Gene ID: 11163 |
|---|
| Catalog # | NBP1-84250 |
|---|
| Price | |
|---|
| Order / More Info | NUDT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|