| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC37A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC37A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC37A4. This antibody reacts with human. The SLC37A4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC37A4(solute carrier family 37 (glucose-6-phosphate transporter), member 4) The peptide sequence was selected from the N terminal of SLC37A4. Peptide sequence LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWL |
|---|
| Other Names | G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19 |
|---|
| Gene, Accession # | SLC37A4, Gene ID: 2542, Accession: O43826, SwissProt: O43826 |
|---|
| Catalog # | NBP1-59877 |
|---|
| Price | |
|---|
| Order / More Info | SLC37A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|