| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC38A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC38A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC38A1. This antibody reacts with human. The SLC38A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC38A1(solute carrier family 38, member 1) The peptide sequence was selected from the middle region of SLC38A1. Peptide sequence LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN. |
|---|
| Other Names | Amino acid transporter A1, ATA1SNAT1, NAT2N-system amino acid transporter 2, SAT1amino acid transporter system A1, sodium-coupled neutral amino acid transporter 1, Solute carrier family 38 member 1, solute carrier family 38, member 1, System A amino acid transporter 1, System N amino acid transporter 1 |
|---|
| Gene, Accession # | SLC38A1, Gene ID: 81539, Accession: Q9H2H9, SwissProt: Q9H2H9 |
|---|
| Catalog # | NBP1-59649 |
|---|
| Price | |
|---|
| Order / More Info | SLC38A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|