| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC38A10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC38A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC38A10. This antibody reacts with human. The SLC38A10 Antibody has been validated for the following applications: Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVAVAEDGREKPKLPKEREELEQAQIKGPVDVPGREDGKEAPEEAQLDRPGQGIAVPV |
|---|
| Other Names | FLJ35718, FLJ46399, MGC15523, PP1744, putative sodium-coupled neutral amino acid transporter 10, solute carrier family 38, member 10 |
|---|
| Gene, Accession # | SLC38A10, Gene ID: 124565 |
|---|
| Catalog # | NBP1-81193-25ul |
|---|
| Price | |
|---|
| Order / More Info | SLC38A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|