| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC38A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC38A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC38A3. This antibody reacts with human. The SLC38A3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM. |
|---|
| Other Names | G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1 |
|---|
| Gene, Accession # | SLC38A3, Gene ID: 10991, Accession: Q99624, SwissProt: Q99624 |
|---|
| Catalog # | NBP1-60103-20ul |
|---|
| Price | |
|---|
| Order / More Info | SLC38A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|