| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC38A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC38A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC38A4. This antibody reacts with human. The SLC38A4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC38A4(solute carrier family 38, member 4) The peptide sequence was selected from the middle region of SLC38A4. Peptide sequence LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV. |
|---|
| Other Names | Amino acid transporter A3, ATA3MGC126876, FLJ10191, N amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 4, NAT3amino acid transporter system A3, PAAT, SNAT4, sodium-coupled neutral amino acid transporter 4, Solute carrier family 38 member 4, solute carrier family 38, member 4, System A amino acid transporter 3, System N amino acid transporter 3 |
|---|
| Gene, Accession # | SLC38A4, Gene ID: 55089, Accession: Q969I6, SwissProt: Q969I6 |
|---|
| Catalog # | NBP1-55228 |
|---|
| Price | |
|---|
| Order / More Info | SLC38A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|