| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC39A10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC39A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC39A10. This antibody reacts with human. The SLC39A10 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC39A10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTK |
|---|
| Other Names | DKFZp564L2123, DKFZp781L10106, FLJ90515, KIAA1265, LZT-Hs2, MGC126565, MGC138428, solute carrier family 39 (metal ion transporter), member 10, solute carrier family 39 (zinc transporter), member 10, Solute carrier family 39 member 10, zinc transporter ZIP10, ZIP10, ZIP-10, Zrt- and Irt-like protein 10 |
|---|
| Gene, Accession # | SLC39A10, Gene ID: 57181 |
|---|
| Catalog # | NBP2-57813 |
|---|
| Price | |
|---|
| Order / More Info | SLC39A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|