| Edit |   |
|---|
| Antigenic Specificity | SLC39A11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC39A11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC39A11. This antibody reacts with human. The SLC39A11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC39A11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW |
|---|
| Other Names | C17orf26, chromosome 17 open reading frame 26, solute carrier family 39 (metal ion transporter), member 11, Solute carrier family 39 member 11, zinc transporter ZIP11, ZIP11, ZIP-11, Zrt- and Irt-like protein 11 |
|---|
| Gene, Accession # | SLC39A11, Gene ID: 201266 |
|---|
| Catalog # | NBP2-58224 |
|---|
| Price | |
|---|
| Order / More Info | SLC39A11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|