| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC3A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC3A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC3A1. This antibody reacts with human. The SLC3A1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN |
|---|
| Other Names | activator of cystine, dibasic and neutral amino acid transport), member 1, amino acid transporter 1, ATR1SLC3A1 variant C, B(0+)-type amino acid transport protein, CSNU1, D2h, D2HSLC3A1 variant D, dibasic and neutral amino acid transporters), FLJ34681, member 1, NBATneutral and basic amino acid transport protein rBAT, RBATSLC3A1 variant B, SLC3A1 variant E, SLC3A1 variant F, SLC3A1 variant G, solute carrier family 3 (cystine, dibasic and neutral amino acid transporters |
|---|
| Gene, Accession # | SLC3A1, Gene ID: 6519 |
|---|
| Catalog # | NBP2-68912 |
|---|
| Price | |
|---|
| Order / More Info | SLC3A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|