| Edit |   |
|---|
| Antigenic Specificity | SLC41A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC41A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC41A1. This antibody reacts with human. The SLC41A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC41A1(solute carrier family 41, member 1) The peptide sequence was selected from the N terminal of SLC41A1. Peptide sequence TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP. |
|---|
| Other Names | MgtE, solute carrier family 41 member 1, solute carrier family 41, member 1 |
|---|
| Gene, Accession # | SLC41A1, Gene ID: 254428, Accession: Q8IVJ1, SwissProt: Q8IVJ1 |
|---|
| Catalog # | NBP1-59693 |
|---|
| Price | |
|---|
| Order / More Info | SLC41A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|