| Edit |   |
| Antigenic Specificity | SLC25A24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SLC25A24 Antibody |
| Immunogen | The immunogen for anti-SLC25A24 antibody: synthetic peptide directed towards the N terminal of human SLC25A24. Synthetic peptide located within the following region: MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV |
| Other Names | APC1, SCAMC1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 |
| Gene, Accession # | SCMC1, Accession: NM_213651 |
| Catalog # | TA334637 |
| Price | |
| Order / More Info | SLC25A24 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |