| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BICD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BICD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BICD1. This antibody reacts with human. The BICD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BICD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
|---|
| Other Names | Bicaudal D (Drosophila) homolog 1, bicaudal D homolog 1 (Drosophila), BICD, Bic-D 1, cytoskeleton-like bicaudal D protein homolog 1, protein bicaudal D homolog 1 |
|---|
| Gene, Accession # | BICD1, Gene ID: 636 |
|---|
| Catalog # | NBP1-85843 |
|---|
| Price | |
|---|
| Order / More Info | BICD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24920579 |
|---|
| 产品资料 |
|
|