| 产品详情 |
| Edit |   |
| Antigenic Specificity | SGTA |
| Clone | 2E11 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SGTA Antibody (2E11) from Novus Biologicals is a mouse monoclonal antibody to SGTA. This antibody reacts with human. The SGTA Antibody (2E11) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. |
| Immunogen | SGTA (NP_003012.1, 42 a.a. - 123 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA |
| Other Names | alphaSGT, Alpha-SGT, protein containing three tetratricopeptide repeats, SGT1, SGThSGT, small glutamine-rich tetratricopeptide repeat (TPR)-containing, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha, small glutamine-rich tetratricopeptide repeat-containing protein alpha, UBP, Vpu-binding protein |
| Gene, Accession # | SGTA, Gene ID: 6449, Accession: NP_003012, SwissProt: NP_003012 |
| Catalog # | H00006449-M06 |
| Price | |
| Order / More Info | SGTA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|