| Edit |   |
|---|
| Antigenic Specificity | SHANK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHANK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHANK1. This antibody reacts with human. The SHANK1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SHANK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPGPGGLASLGKHRPKGFFATESSFDPHHR |
|---|
| Other Names | SH3 and multiple ankyrin repeat domains 1, SH3 and multiple ankyrin repeat domains protein 1, Shank1, Somatostatin receptor-interacting protein, SSTR-interacting protein, SSTRIPSPANK-1, synamon |
|---|
| Gene, Accession # | SHANK1, Gene ID: 50944, Accession: Q9Y566, SwissProt: Q9Y566 |
|---|
| Catalog # | NBP2-33971 |
|---|
| Price | |
|---|
| Order / More Info | SHANK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|