| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC6A4/5-HTTLPR/Serotonin transporter |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC6A4/5-HTTLPR/Serotonin transporter Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A4/5-HTTLPR/Serotonin transporter. This antibody reacts with human. The SLC6A4/5-HTTLPR/Serotonin transporter Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC6A4/5-HTTLPR/Serotonin transporter antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI |
|---|
| Other Names | 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT |
|---|
| Gene, Accession # | SLC6A4, Gene ID: 6532 |
|---|
| Catalog # | NBP2-57729 |
|---|
| Price | |
|---|
| Order / More Info | SLC6A4/5-HTTLPR/Serotonin transporter Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|