| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC6A4/5-HTTLPR/Serotonin transporter |
|---|
| Clone | 2A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunoprecipitation. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. IP usage was reported in scientific literature. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) from Novus Biologicals is a mouse monoclonal antibody to SLC6A4/5-HTTLPR/Serotonin transporter. This antibody reacts with human, rat. The SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) has been validated for the following applications: ELISA, Immunoprecipitation. |
|---|
| Immunogen | SLC6A4 (NP_001036, 181 a.a. - 252 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS |
|---|
| Other Names | 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT |
|---|
| Gene, Accession # | SLC6A4, Gene ID: 6532, Accession: NP_001036, SwissProt: NP_001036 |
|---|
| Catalog # | H00006532-M06 |
|---|
| Price | |
|---|
| Order / More Info | SLC6A4/5-HTTLPR/Serotonin transporter Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22451649 |
|---|
| 产品资料 |
|
|