| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC7A5/LAT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC7A5/LAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC7A5/LAT1. This antibody reacts with human. The SLC7A5/LAT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC7A5/LAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Other Names | 4F2 LC, CD98, CD98LC, D16S469EL-type amino acid transporter 1, E16, Integral membrane protein E16, large neutral amino acids transporter 1, large neutral amino acids transporter small subunit 1, LAT1hLAT1, MPE16CD98 light chain, sodium-independent neutral amino acid transporter LAT1,4F2LC, solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain, Solute carrier family 7 member 5, y+ system cationic amino acid transporter |
| Gene, Accession # | SLC7A5, Gene ID: 8140, Accession: Q01650, SwissProt: Q01650 |
| Catalog # | NBP2-33662 |
| Price | |
| Order / More Info | SLC7A5/LAT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|