| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC13A3/NaDC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC13A3/NaDC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC13A3/NaDC3. This antibody reacts with human. The SLC13A3/NaDC3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC13A3/NaDC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP |
|---|
| Other Names | hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3 |
|---|
| Gene, Accession # | SLC13A3, Gene ID: 64849 |
|---|
| Catalog # | NBP1-82602 |
|---|
| Price | |
|---|
| Order / More Info | SLC13A3/NaDC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|