| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC6A2/NET/Noradrenaline transporter |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC6A2/NET/Noradrenaline transporter Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A2/NET/Noradrenaline transporter. This antibody reacts with human. The SLC6A2/NET/Noradrenaline transporter Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA |
|---|
| Other Names | NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5 |
|---|
| Gene, Accession # | SLC6A2, Gene ID: 6530 |
|---|
| Catalog # | NBP2-62704 |
|---|
| Price | |
|---|
| Order / More Info | SLC6A2/NET/Noradrenaline transporter Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|