| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VARS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Aggregation, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VARS Antibody from Novus Biologicals is a rabbit polyclonal antibody to VARS. This antibody reacts with human. The VARS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Aggregation, Knockdown Validated. Specificity of human VARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASG YPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML |
|---|
| Other Names | EC 6.1.1, EC 6.1.1.9, G7AVARS1, Protein G7a, valine tRNA ligase 1, cytoplasmic, Valine--tRNA ligase, ValRS, valyl-tRNA synthetase, valyl-tRNA synthetase 2, VARS2valRS |
|---|
| Gene, Accession # | VARS, Gene ID: 7407 |
|---|
| Catalog # | NBP2-13513 |
|---|
| Price | |
|---|
| Order / More Info | VARS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|