| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VARS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VARS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VARS2. This antibody reacts with human. The VARS2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human VARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE |
|---|
| Other Names | DKFZP434L1435, EC 6.1.1, EC 6.1.1.9, Em:AB023048.4, KIAA1885MGC138259, MGC142165, valine tRNA ligase 2, mitochondrial (putative), Valine--tRNA ligase, valRS, valyl-tRNA synthetase 2, mitochondrial (putative), valyl-tRNA synthetase 2-like, valyl-tRNA synthetase like, valyl-tRNA synthetase, mitochondrial, Valyl-tRNA synthetase-like, VARS2L, VARSL |
|---|
| Gene, Accession # | VARS2, Gene ID: 57176 |
|---|
| Catalog # | NBP2-56061 |
|---|
| Price | |
|---|
| Order / More Info | VARS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|