| Edit |   |
| Antigenic Specificity | Vasohibin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Vasohibin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Vasohibin. This antibody reacts with human. The Vasohibin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to VASH1(vasohibin 1) The peptide sequence was selected from the N terminal of VASH1. Peptide sequence ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER. |
| Other Names | KIAA1036vasohibin-1, VASH, vasohibin 1 |
| Gene, Accession # | VASH1, Gene ID: 22846, Accession: Q7L8A9, SwissProt: Q7L8A9 |
| Catalog # | NBP1-52934-20ul |
| Price | |
| Order / More Info | Vasohibin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |