| 产品详情 |
| Edit |   |
| Antigenic Specificity | Aminopeptidase P1/XPNPEP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aminopeptidase P1/XPNPEP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aminopeptidase P1/XPNPEP1. This antibody reacts with human. The Aminopeptidase P1/XPNPEP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Aminopeptidase P1/XPNPEP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC |
| Other Names | Aminoacylproline aminopeptidase, APP1, cytosolic, Cytosolic aminopeptidase P, EC 3.4.11.9, sAmp, xaa-Pro aminopeptidase 1, XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble, X-prolyl aminopeptidase 1, soluble |
| Gene, Accession # | XPNPEP1, Gene ID: 7511, Accession: Q9NQW7, Q9NQW7, Q9NQW7, Q9NQW7 |
| Catalog # | NBP1-80614 |
| Price | |
| Order / More Info | Aminopeptidase P1/XPNPEP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|