| Edit |   |
|---|
| Antigenic Specificity | AGXT2L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGXT2L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGXT2L1. This antibody reacts with human. The AGXT2L1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AGXT2L1(alanine-glyoxylate aminotransferase 2-like 1) The peptide sequence was selected from the middle region of AGXT2L1. Peptide sequence KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT. |
|---|
| Other Names | alanine--glyoxylate aminotransferase 2-like 1, alanine-glyoxylate aminotransferase 2-like 1, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.44 |
|---|
| Gene, Accession # | AGXT2L1, Gene ID: 64850, Accession: Q8TBG4, SwissProt: Q8TBG4 |
|---|
| Catalog # | NBP1-54965-20ul |
|---|
| Price | |
|---|
| Order / More Info | AGXT2L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|