| Edit |   |
|---|
| Antigenic Specificity | IRF5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IRF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IRF5. This antibody reacts with human. The IRF5 Antibody has been validated for the following applications: Western Blot. Specificity of human IRF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEE E |
|---|
| Other Names | IBD14, interferon regulatory factor 5, IRF-5, SLEB10 |
|---|
| Gene, Accession # | IRF5, Gene ID: 3663 |
|---|
| Catalog # | NBP2-14128 |
|---|
| Price | |
|---|
| Order / More Info | IRF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|