| 产品详情 |
| Edit |   |
| Antigenic Specificity | PRP19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRP19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRP19. This antibody reacts with human. The PRP19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human PRP19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV |
| Other Names | hPSO4, NMP200SNEV, Nuclear matrix protein 200, nuclear matrix protein NMP200 related to splicing factor PRP19, pre-mRNA-processing factor 19, PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), PRP19PRP19/PSO4 homolog (S. cerevisiae), PSO4PRP19/PSO4 homolog, Senescence evasion factor, UBOX4 |
| Gene, Accession # | PRPF19, Gene ID: 27339, Accession: Q9UMS4, SwissProt: Q9UMS4 |
| Catalog # | NBP2-38864 |
| Price | |
| Order / More Info | PRP19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|