| 产品详情 |
| Edit |   |
| Antigenic Specificity | PRPF3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRPF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRPF3. This antibody reacts with human. The PRPF3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PRPF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQ |
| Other Names | hPrp3, HPRP3P, HPRP3retinitis pigmentosa 18 (autosomal dominant), Pre-mRNA-splicing factor 3, PRP3, PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae), PRP3 pre-mRNA processing factor 3 homolog (yeast), Prp3p, RP18, U4/U6 small nuclear ribonucleoprotein Prp3, U4/U6 snRNP 90 kDa protein, U4/U6-associated RNA splicing factor |
| Gene, Accession # | PRPF3, Gene ID: 9129 |
| Catalog # | NBP2-57826 |
| Price | |
| Order / More Info | PRPF3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|