| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRPF31 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRPF31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRPF31. This antibody reacts with human. The PRPF31 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PRPF31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN |
|---|
| Other Names | DKFZp566J153, hPrp31, NY-BR-99, Pre-mRNA-processing factor 31, Protein 61K, PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae), PRP31 pre-mRNA processing factor 31 homolog (yeast), PRP31RP11, Serologically defined breast cancer antigen NY-BR-99, U4/U6 small nuclear ribonucleoprotein Prp31, U4/U6 snRNP 61 kDa protein |
|---|
| Gene, Accession # | PRPF31, Gene ID: 26121 |
|---|
| Catalog # | NBP2-57695 |
|---|
| Price | |
|---|
| Order / More Info | PRPF31 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|