| Edit |   |
| Antigenic Specificity | IQCK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IQCK Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCK. This antibody reacts with human. The IQCK Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IQCK(IQ motif containing K) The peptide sequence was selected from the middle region of IQCK. Peptide sequence GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI. |
| Other Names | FLJ20115, FLJ36575, IQ domain-containing protein K, IQ motif containing K, MGC35048 |
| Gene, Accession # | IQCK, Gene ID: 124152, Accession: Q8N0W5, SwissProt: Q8N0W5 |
| Catalog # | NBP1-56735-20ul |
| Price | |
| Order / More Info | IQCK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |