| Edit |   |
|---|
| Antigenic Specificity | IQCK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IQCK Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCK. This antibody reacts with human. The IQCK Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IQCK(IQ motif containing K) The peptide sequence was selected from the middle region of IQCK. Peptide sequence GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI. |
|---|
| Other Names | FLJ20115, FLJ36575, IQ domain-containing protein K, IQ motif containing K, MGC35048 |
|---|
| Gene, Accession # | IQCK, Gene ID: 124152, Accession: Q8N0W5, SwissProt: Q8N0W5 |
|---|
| Catalog # | NBP1-56735 |
|---|
| Price | |
|---|
| Order / More Info | IQCK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|