| Edit |   |
|---|
| Antigenic Specificity | IRAK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IRAK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IRAK2. This antibody reacts with human. The IRAK2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IRAK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL |
|---|
| Other Names | interleukin-1 receptor associated kinase-2, interleukin-1 receptor-associated kinase 2, interleukin-1 receptor-associated kinase-like 2, IRAK-2, MGC150550 |
|---|
| Gene, Accession # | IRAK2, Gene ID: 3656, Accession: O43187, SwissProt: O43187 |
|---|
| Catalog # | NBP2-38629 |
|---|
| Price | |
|---|
| Order / More Info | IRAK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|