| Edit |   |
| Antigenic Specificity | RAB9B - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, dog, human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RAB9B Antibody - N-terminal region |
| Immunogen | The immunogen for anti-RAB9B antibody: synthetic peptide directed towards the N terminal of human RAB9B. Synthetic peptide located within the following region: KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF |
| Other Names | RAB9L, Rab9L, RAB9B, member RAS oncogene family |
| Gene, Accession # | RAB9B, Accession: NM_016370 |
| Catalog # | TA345031 |
| Price | |
| Order / More Info | RAB9B - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |