| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLHL32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL32. This antibody reacts with human. The KLHL32 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KLHL32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHP LVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQS |
|---|
| Other Names | BKLHD5, BTB and kelch domain containing 5, BTB and kelch domain-containing protein 5, dJ21F7.1, kelch-like 32 (Drosophila), kelch-like protein 32, KIAA1900RP1-39B17.1, MGC51280, MGC87753, UG0030H05 |
|---|
| Gene, Accession # | KLHL32, Gene ID: 114792 |
|---|
| Catalog # | NBP2-14169 |
|---|
| Price | |
|---|
| Order / More Info | KLHL32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|