| Edit |   |
|---|
| Antigenic Specificity | KLHL33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL33. This antibody reacts with human. The KLHL33 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLHL33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSPARCLALFPMAEAPGLERLWSKARHYLLTHLPAVALCPAFPSLPAACLAELLDSDELHVQEEFEAFVAARCWLAANPETQES |
|---|
| Other Names | EC 2.3.1.48, EC 2.7.1.11, Kelch-Like 33, Kelch-Like 33 (Drosophila), Kelch-Like Family Member 33, Kelch-Like Protein 33 |
|---|
| Gene, Accession # | KLHL33, Gene ID: 123103, Accession: A6NCF5, SwissProt: A6NCF5 |
|---|
| Catalog # | NBP2-34165 |
|---|
| Price | |
|---|
| Order / More Info | KLHL33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|