| Edit |   |
| Antigenic Specificity | KLHL35 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLHL35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL35. This antibody reacts with human. The KLHL35 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FLJ33790The immunogen for this antibody is FLJ33790. Peptide sequence RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR. |
| Other Names | FLJ33790, kelch-like 35 (Drosophila) |
| Gene, Accession # | KLHL35, Gene ID: 283212, Accession: NP_001034637, SwissProt: NP_001034637 |
| Catalog # | NBP1-79550 |
| Price | |
| Order / More Info | KLHL35 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |