| Edit |   |
| Antigenic Specificity | KLHL9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLHL9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL9. This antibody reacts with human. The KLHL9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. |
| Other Names | FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 |
| Gene, Accession # | KLHL9, Gene ID: 55958, Accession: Q9P2J3, SwissProt: Q9P2J3 |
| Catalog # | NBP1-55091-20ul |
| Price | |
| Order / More Info | KLHL9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |