| Edit |   |
|---|
| Antigenic Specificity | KLHL11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL11. This antibody reacts with human. The KLHL11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLHL11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC |
|---|
| Other Names | FLJ10572, kelch-like 11 (Drosophila), kelch-like protein 11 |
|---|
| Gene, Accession # | KLHL11, Gene ID: 55175, Accession: Q9NVR0, SwissProt: Q9NVR0 |
|---|
| Catalog # | NBP2-38721 |
|---|
| Price | |
|---|
| Order / More Info | KLHL11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|