| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTPRB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTPRB Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTPRB. This antibody reacts with human. The PTPRB Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PTPRB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSD |
|---|
| Other Names | DKFZp686E2262, DKFZp686H15164, EC 3.1.3.48, FLJ44133, HPTPB, HPTP-BETA, MGC142023, MGC59935, protein tyrosine phosphatase, receptor type, B, protein tyrosine phosphatase, receptor type, beta polypeptide, Protein-tyrosine phosphatase beta, PTPB, receptor-type tyrosine-protein phosphatase beta, R-PTP-BETA, Vascular endothelial protein tyrosine phosphatase, VEPTP, VE-PTP |
|---|
| Gene, Accession # | PTPRB, Gene ID: 5787 |
|---|
| Catalog # | NBP2-56421 |
|---|
| Price | |
|---|
| Order / More Info | PTPRB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|