| Edit |   |
|---|
| Antigenic Specificity | B230358A15Rik |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-B230358A15Rik antibody |
|---|
| Immunogen | The immunogen for anti-B230358A15Rik antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDKYKSLLDRVMPILKESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESL |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Hsf3, Accession: NM_172931 |
|---|
| Catalog # | TA329601 |
|---|
| Price | |
|---|
| Order / More Info | B230358A15Rik Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|