| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Syndecan-2/CD362 |
|---|
| Clone | 1B2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syndecan-2/CD362 Antibody (1B2) from Novus Biologicals is a mouse monoclonal antibody to Syndecan-2/CD362. This antibody reacts with human. The Syndecan-2/CD362 Antibody (1B2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SDC2 (NP_002989.2, 32 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV |
|---|
| Other Names | CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2 |
|---|
| Gene, Accession # | SDC2, Gene ID: 6383, Accession: NP_002989, SwissProt: NP_002989 |
|---|
| Catalog # | H00006383-M04 |
|---|
| Price | |
|---|
| Order / More Info | Syndecan-2/CD362 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|