| Edit |   |
|---|
| Antigenic Specificity | Dlx1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dlx1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dlx1. This antibody reacts with rat. The Dlx1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Dlx1 - C-terminal region. Peptide sequence SAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM. |
|---|
| Other Names | distal-less homeo box 1, distal-less homeobox 1, homeobox protein DLX-1 |
|---|
| Gene, Accession # | DLX1, Gene ID: 1745, Accession: NP_001094001 |
|---|
| Catalog # | NBP1-98334-20ul |
|---|
| Price | |
|---|
| Order / More Info | Dlx1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|