| Edit |   |
| Antigenic Specificity | DLX5 |
| Clone | 4C6 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DLX5 Antibody (4C6) from Novus Biologicals is a mouse monoclonal antibody to DLX5. This antibody reacts with human. The DLX5 Antibody (4C6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | DLX5 (NP_005212 191 a.a. - 279 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH |
| Other Names | distal-less homeo box 5, distal-less homeobox 5, homeobox protein DLX-5 |
| Gene, Accession # | DLX5, Gene ID: 1749, Accession: NP_005212, SwissProt: NP_005212 |
| Catalog # | H00001749-M09 |
| Price | |
| Order / More Info | DLX5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |