| Edit |   |
| Antigenic Specificity | BCAS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCAS1. This antibody reacts with human. The BCAS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BCAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ |
| Other Names | breast carcinoma amplified sequence 1, breast carcinoma-amplified sequence 1, NABC1AIBC1Amplified and overexpressed in breast cancer, Novel amplified in breast cancer 1 |
| Gene, Accession # | BCAS1, Gene ID: 8537, Accession: O75363, SwissProt: O75363 |
| Catalog # | NBP2-38736 |
| Price | |
| Order / More Info | BCAS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |