| Edit |   |
|---|
| Antigenic Specificity | LYRM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LYRM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYRM1. This antibody reacts with human. The LYRM1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LYRM1(LYR motif containing 1) The peptide sequence was selected from the middle region of LYRM1. Peptide sequence KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP. |
|---|
| Other Names | A211C6.1, LYR motif containing 1, LYR motif-containing protein 1 |
|---|
| Gene, Accession # | LYRM1, Gene ID: 57149, Accession: O43325, SwissProt: O43325 |
|---|
| Catalog # | NBP1-54901-20ul |
|---|
| Price | |
|---|
| Order / More Info | LYRM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|