| Edit |   |
| Antigenic Specificity | LYRM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LYRM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYRM1. This antibody reacts with human. The LYRM1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LYRM1(LYR motif containing 1) The peptide sequence was selected from the middle region of LYRM1. Peptide sequence KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP. |
| Other Names | A211C6.1, LYR motif containing 1, LYR motif-containing protein 1 |
| Gene, Accession # | LYRM1, Gene ID: 57149, Accession: O43325, SwissProt: O43325 |
| Catalog # | NBP1-54901 |
| Price | |
| Order / More Info | LYRM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |