| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDFIP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDFIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDFIP1. This antibody reacts with human. The NDFIP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NDFIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP |
|---|
| Other Names | Breast cancer-associated protein SGA-1M, MGC10924, N4WBP5Putative NF-kappa-B-activating protein 164, Nedd4 family interacting protein 1, NEDD4 family-interacting protein 1, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NFKB and MAPK-activating protein |
|---|
| Gene, Accession # | NDFIP1, Gene ID: 80762 |
|---|
| Catalog # | NBP1-81234 |
|---|
| Price | |
|---|
| Order / More Info | NDFIP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|