| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM10. This antibody reacts with human. The RBM10 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human RBM10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST |
|---|
| Other Names | DXS8237ERNA-binding motif protein 10, G patch domain-containing protein 9, GPATC9TARPS, GPATCH9MGC1132, KIAA0122RNA-binding protein S1-1, MGC997, RNA binding motif protein 10, RNA-binding protein 10, S1-1, ZRANB5 |
|---|
| Gene, Accession # | RBM10, Gene ID: 8241 |
|---|
| Catalog # | NBP2-56831 |
|---|
| Price | |
|---|
| Order / More Info | RBM10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|