| Edit |   |
| Antigenic Specificity | JMJD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat, porcine, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-JMJD4 Antibody |
| Immunogen | The immunogen for anti-JMJD4 antibody: synthetic peptide directed towards the C terminal of human JMJD4. Synthetic peptide located within the following region: AAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP |
| Other Names | jumonji domain containing 4 |
| Gene, Accession # | JMJD4, Accession: NM_023007 |
| Catalog # | TA345373 |
| Price | |
| Order / More Info | JMJD4 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |