| Edit |   |
|---|
| Antigenic Specificity | CHCHD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHCHD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHCHD3. This antibody reacts with human. The CHCHD3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3. Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY. |
|---|
| Other Names | coiled-coil-helix-coiled-coil-helix domain containing 3, FLJ20420, mitochondrial |
|---|
| Gene, Accession # | CHCHD3, Gene ID: 54927, Accession: Q9NX63, SwissProt: Q9NX63 |
|---|
| Catalog # | NBP1-56871-20ul |
|---|
| Price | |
|---|
| Order / More Info | CHCHD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|